PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10026871m
Common NameCARUB_v10026871mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MYB
Protein Properties Length: 300aa    MW: 35021.1 Da    PI: 5.4236
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10026871mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.91.1e-182875148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT eEd+ l+++++ +G g+W++ ar+ g++Rt+k+c++rw++yl
  Carubv10026871m 28 RGPWTVEEDLELINYIATHGEGRWNSLARCAGLKRTGKSCRLRWLNYL 75
                     89********************************************97 PP

2Myb_DNA-binding50.64.3e-1681124146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T eE++l+++++ ++G++ W++Ia++++ gRt++++k++w++
  Carubv10026871m  81 RGNITLEEQLLILELHSRWGNR-WSKIAQYLP-GRTDNEIKNYWRT 124
                      7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.6352375IPR017930Myb domain
SuperFamilySSF466895.62E-3125122IPR009057Homeodomain-like
SMARTSM007174.5E-162777IPR001005SANT/Myb domain
PfamPF002496.8E-172875IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.3E-232982IPR009057Homeodomain-like
CDDcd001678.59E-123075No hitNo description
PROSITE profilePS5129422.91776130IPR017930Myb domain
SMARTSM007172.9E-1480128IPR001005SANT/Myb domain
PfamPF002497.2E-1581124IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.2E-2283129IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 300 aa     Download sequence    Send to blast
MDDKARSLKI NKNMEDFADV EEEMELRRGP WTVEEDLELI NYIATHGEGR WNSLARCAGL  60
KRTGKSCRLR WLNYLRPDVR RGNITLEEQL LILELHSRWG NRWSKIAQYL PGRTDNEIKN  120
YWRTRVQKHA KQLRCDVNSQ LFKDTMKYLW MPRLVERIQA TNTRSVSTSD QLVINNNNNN  180
TNMEHCGLIM SNPNGYIITS EHSNVAVSPS SDLTECHVKI CSDQDLVEQQ LSSHNYLDNN  240
SGLMFGDVTK MQDESYLNWY ENNVNGIIPN YSDSFWNIGY DEDFWLLQQQ QQVIDNGNF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-262512224120MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5196350.0AY519635.1 Arabidopsis thaliana MYB transcription factor (At5g49620) mRNA, complete cds.
GenBankBT0260760.0BT026076.1 Arabidopsis thaliana At5g49620 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006280880.10.0hypothetical protein CARUB_v10026871mg
SwissprotQ9LDE11e-112MY108_ARATH; Transcription factor MYB108
TrEMBLR0GRF20.0R0GRF2_9BRAS; Uncharacterized protein
STRINGfgenesh2_kg.8__837__AT5G49620.11e-163(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G49620.11e-158myb domain protein 78